| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332584.1 | complete | 167 | 630-127(-) |
Amino Acid sequence : | |||
| MGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNVSSSIFQKIQVFEEELKAVLPKEVEAARAAVVGGNPAVANRIKECRSYPLYKFVREELG TEFLTGEKTTSPGEEGDKVFTALSNGLIVDPLLKCLEAWNGEPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,631.090 | ||
| Theoretical pI: | 4.983 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 26.778 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.240 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.228 | ||
| sheet | 0.311 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332584.1 | complete | 167 | 630-127(-) |
Amino Acid sequence : | |||
| MGVNGELHPSRFCEKDLLRVVDREYVFAYIDDPCSATYPLMQKLRQVLVEHALNNGENEKNVSSSIFQKIQVFEEELKAVLPKEVEAARAAVVGGNPAVANRIKECRSYPLYKFVREELG TEFLTGEKTTSPGEEGDKVFTALSNGLIVDPLLKCLEAWNGEPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,631.090 | ||
| Theoretical pI: | 4.983 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 26.778 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.240 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.228 | ||
| sheet | 0.311 | ||