Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332586.1	complete	151	200-655(+)
Amino Acid sequence :
MCLNVNGFVISRHGSLLHCFTHRRVSVACPRDVFTRCTVMQSQNCLVNNLPSIRRHYVHSQNLVTLLLCKYLHHFFLHPRSPSLCCLQRRGTSPHDIRLPLLSPAPRFSPHMPPRGACKQ LLELNRSPRGLPSRQCILHMRRRLLPPCEPA*
Physicochemical properties
Number of amino acids:		151
Molecular weight:		13,233.774
Theoretical pI:		4.968
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8940 9065
Instability index:		27.053
aromaticity		0.081
GRAVY		-0.280
Secondary Structure Fraction
Helix		0.285
turn		0.220
sheet		0.252

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332586.1	5prime_partial	123	761-390(-)
Amino Acid sequence :
DKIGVETDKMGRILVNDRFATNVPGVYAIGDVIPGPMLAHKAEEDGVACVEYIAGKEGHVDYDLVPGVVYTHPEVAYVGKTEEQVKAMGVEYRVGKFPFFANSRAKAIGGAEKSGEDTCR EGE*
Physicochemical properties
Number of amino acids:		123
Molecular weight:		13,233.774
Theoretical pI:		4.968
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8940 9065
Instability index:		27.053
aromaticity		0.081
GRAVY		-0.280
Secondary Structure Fraction
Helix		0.285
turn		0.220
sheet		0.252