| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332591.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| GHCNFEHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDALYESSLVRKEDVPDVVHLTHLTTPESIFHLRLGFAHFASQPYISKWYLWLMWPLTVWSMM ITWIYGRTFVVERNIFKNLKLQTWALPKYTIQYYMQWQREWINNLIEDAIVEADAKGVKVLSLGLLNQEEGLNRNGEIFLRRNPQLKVKLVDGSSLAVAIVLNSIPKGTTXVVLRGNITK VAYS | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 28,470.672 | ||
| Theoretical pI: | 9.248 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66350 | ||
| Instability index: | 33.242 | ||
| aromaticity | 0.144 | ||
| GRAVY | -0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.403 | ||
| turn | 0.214 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332591.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
| GHCNFEHIPKRLFSIFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDALYESSLVRKEDVPDVVHLTHLTTPESIFHLRLGFAHFASQPYISKWYLWLMWPLTVWSMM ITWIYGRTFVVERNIFKNLKLQTWALPKYTIQYYMQWQREWINNLIEDAIVEADAKGVKVLSLGLLNQEEGLNRNGEIFLRRNPQLKVKLVDGSSLAVAIVLNSIPKGTTXVVLRGNITK VAYS | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 28,470.672 | ||
| Theoretical pI: | 9.248 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 66350 66350 | ||
| Instability index: | 33.242 | ||
| aromaticity | 0.144 | ||
| GRAVY | -0.084 | ||
Secondary Structure Fraction | |||
| Helix | 0.403 | ||
| turn | 0.214 | ||
| sheet | 0.230 | ||