Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332600.1 | 5prime_partial | 149 | 694-245(-) |
Amino Acid sequence : | |||
QEGNTHIKKKLKKMGIDPVTHKPLSPESAEAQPESAEAQPETLLVDSSDFCIDEIPVMEPHEILLPSDQDSPTSSFFGGAWSANAGGEKKLTQSFEDYYSEILNSNIWDDDFGDTFDLLA DYDANLMGKNQALDFESCLAPVGEDSWMS* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 13,223.703 | ||
Theoretical pI: | 11.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 40.051 | ||
aromaticity | 0.071 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.150 | ||
sheet | 0.177 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332600.1 | complete | 141 | 214-639(+) |
Amino Acid sequence : | |||
MSTHVSNPMRTKTSKNLHPREPNKIQNPAPDSSPSNSRRNQPTNQTYLRNHRPIYCCSESRCNNPRSSVSVFFPPPRLPTTRRQKRTTWASPDRREAGSHVAPSPEFRRCRNPNCPLIKF QAALPLIPAALPLIPARGACG* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 13,223.703 | ||
Theoretical pI: | 11.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 40.051 | ||
aromaticity | 0.071 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.150 | ||
sheet | 0.177 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332600.1 | complete | 113 | 224-565(+) |
Amino Acid sequence : | |||
MSVIQCVLRHPRIFTHGSQTRFKIQRLILPHQIRVVISQQIKRISEIIVPYIAVQNLAVIILEALCQFFFPPRVCRPRAAKKGRRGRVLIGGKQDLMWLHHRNFVDAEIRTVH* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,223.703 | ||
Theoretical pI: | 11.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 40.051 | ||
aromaticity | 0.071 | ||
GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
Helix | 0.381 | ||
turn | 0.150 | ||
sheet | 0.177 |