| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332600.1 | 5prime_partial | 149 | 694-245(-) |
Amino Acid sequence : | |||
| QEGNTHIKKKLKKMGIDPVTHKPLSPESAEAQPESAEAQPETLLVDSSDFCIDEIPVMEPHEILLPSDQDSPTSSFFGGAWSANAGGEKKLTQSFEDYYSEILNSNIWDDDFGDTFDLLA DYDANLMGKNQALDFESCLAPVGEDSWMS* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 13,223.703 | ||
| Theoretical pI: | 11.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.051 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.150 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332600.1 | complete | 141 | 214-639(+) |
Amino Acid sequence : | |||
| MSTHVSNPMRTKTSKNLHPREPNKIQNPAPDSSPSNSRRNQPTNQTYLRNHRPIYCCSESRCNNPRSSVSVFFPPPRLPTTRRQKRTTWASPDRREAGSHVAPSPEFRRCRNPNCPLIKF QAALPLIPAALPLIPARGACG* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 13,223.703 | ||
| Theoretical pI: | 11.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.051 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.150 | ||
| sheet | 0.177 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332600.1 | complete | 113 | 224-565(+) |
Amino Acid sequence : | |||
| MSVIQCVLRHPRIFTHGSQTRFKIQRLILPHQIRVVISQQIKRISEIIVPYIAVQNLAVIILEALCQFFFPPRVCRPRAAKKGRRGRVLIGGKQDLMWLHHRNFVDAEIRTVH* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,223.703 | ||
| Theoretical pI: | 11.624 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 40.051 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.150 | ||
| sheet | 0.177 | ||