Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332601.1 | 5prime_partial | 146 | 3-443(+) |
Amino Acid sequence : | |||
NTHIKKKLKKMGIDPVTHKPLSPESAEAQPESAEAQPETLLVDSSDFCIDEIPVMEPHEILLPSDQDSPTSSSSGGAWSANAAGDVELTQSFEDYYSEILNSNIWDDDFGDTFDLLADYD ANLMGKNQALDFESCLAPVGEDSWMS* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 13,191.625 | ||
Theoretical pI: | 11.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.980 | ||
aromaticity | 0.044 | ||
GRAVY | 0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.142 | ||
sheet | 0.195 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332601.1 | complete | 141 | 474-49(-) |
Amino Acid sequence : | |||
MSTHVSNPMRTKTSKNLHPREPNKIQNPAPDSSPSNSRRNQPTNQTYLRNHRPIYCCSESRCNNPRSSVSAPRPQPRLPTTRRRSTTTWASPDRREAGSHVAPSPEFRRCRNPNCPLIKF QAALPLIPAALPLIPARGACG* | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 13,191.625 | ||
Theoretical pI: | 11.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.980 | ||
aromaticity | 0.044 | ||
GRAVY | 0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.142 | ||
sheet | 0.195 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332601.1 | complete | 113 | 464-123(-) |
Amino Acid sequence : | |||
MSVIQCVLRHPRIFTHGSQTRFKIQRLILPHQIRVVISQQIKRISEIIVPYIAVQNLAVIILEALCQLHVPSRVCRPRAAARRRRGRVLIGGKQDLMWLHHRNFVDAEIRTVH* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,191.625 | ||
Theoretical pI: | 11.786 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.980 | ||
aromaticity | 0.044 | ||
GRAVY | 0.073 | ||
Secondary Structure Fraction | |||
Helix | 0.372 | ||
turn | 0.142 | ||
sheet | 0.195 |