| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332615.1 | 3prime_partial | 225 | 105-779(+) |
Amino Acid sequence : | |||
| MEEGVLSDTDQQLMLSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYIGNEGGLTAQSVHSPPRESDVSRNNPNLSELEKDLVEKDGRQDNGDDIRPPLPVKRDVLYDNPMPYRNFPR ARDSSYAAHSVVPFRNFEEEMKHPGVWEADGASSSSAGDRTQDNLASLYRPPFALMFHGPFEKAKDNSRMQNKWLIVNMQSTKEFSSHTLNRDTWANEAVASTIK | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 12,632.748 | ||
| Theoretical pI: | 6.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 52.672 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.174 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332615.1 | complete | 109 | 564-235(-) |
Amino Acid sequence : | |||
| MKHHLLPKLQDVSFPPQNCGMEQQSELHMMNLLLLENCGRALDCHIKHLFSQVKVDVYHLHCPVCHLSLPNPFPAHLDLDCCETRRFLLVENAQIAQLAPLHFLYKKVE* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,632.748 | ||
| Theoretical pI: | 6.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 52.672 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.174 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332615.1 | 3prime_partial | 225 | 105-779(+) |
Amino Acid sequence : | |||
| MEEGVLSDTDQQLMLSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYIGNEGGLTAQSVHSPPRESDVSRNNPNLSELEKDLVEKDGRQDNGDDIRPPLPVKRDVLYDNPMPYRNFPR ARDSSYAAHSVVPFRNFEEEMKHPGVWEADGASSSSAGDRTQDNLASLYRPPFALMFHGPFEKAKDNSRMQNKWLIVNMQSTKEFSSHTLNRDTWANEAVASTIK | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 12,632.748 | ||
| Theoretical pI: | 6.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 52.672 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.174 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332615.1 | complete | 109 | 564-235(-) |
Amino Acid sequence : | |||
| MKHHLLPKLQDVSFPPQNCGMEQQSELHMMNLLLLENCGRALDCHIKHLFSQVKVDVYHLHCPVCHLSLPNPFPAHLDLDCCETRRFLLVENAQIAQLAPLHFLYKKVE* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,632.748 | ||
| Theoretical pI: | 6.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3355 | ||
| Instability index: | 52.672 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.330 | ||
| turn | 0.174 | ||
| sheet | 0.321 | ||