| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332622.1 | internal | 101 | 304-2(-) |
Amino Acid sequence : | |||
| HEDSLGRMESVWGKDCLEFKPERWISLKGGIKHEPSYKFPAFNAGPRTCLGKEMAFVQMKMVAATIIHHYNVTLVEGHPVYPSDSIILQAKHGLRITLSRS | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,421.139 | ||
| Theoretical pI: | 9.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 53.990 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.238 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332622.1 | internal | 101 | 304-2(-) |
Amino Acid sequence : | |||
| HEDSLGRMESVWGKDCLEFKPERWISLKGGIKHEPSYKFPAFNAGPRTCLGKEMAFVQMKMVAATIIHHYNVTLVEGHPVYPSDSIILQAKHGLRITLSRS | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,421.139 | ||
| Theoretical pI: | 9.009 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 53.990 | ||
| aromaticity | 0.089 | ||
| GRAVY | -0.276 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.238 | ||
| sheet | 0.248 | ||