| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332625.1 | complete | 222 | 38-706(+) |
Amino Acid sequence : | |||
| MEYEGILLGMGNPLLDISAVVDQQFLDKYDVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCA VCVLGGERSLIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESMLLVAEHAIANNKVFATNLSAPFICEFFQEAQEKILPYTDFVFGMKQKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,844.246 | ||
| Theoretical pI: | 5.289 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 34.264 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.212 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332625.1 | complete | 222 | 38-706(+) |
Amino Acid sequence : | |||
| MEYEGILLGMGNPLLDISAVVDQQFLDKYDVKLNNAILAEDKHLPMYDEMTSKFKVDYIAGGATQNSIRVAQWMLQIPGATSYMGSIGKDKYGEEMKKNAKEAGVNVHYYEDDSPTGTCA VCVLGGERSLIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESMLLVAEHAIANNKVFATNLSAPFICEFFQEAQEKILPYTDFVFGMKQKR* | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 24,844.246 | ||
| Theoretical pI: | 5.289 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30370 30620 | ||
| Instability index: | 34.264 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.202 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.212 | ||
| sheet | 0.302 | ||