Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332628.1	5prime_partial	216	1-651(+)
Amino Acid sequence :
GTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVL HDWSDDKCIEILKKCKEAIPTSTGKVMIVDAIINEEGEGDEFLGARLSLDMTMMAMTTLGKERSYKEWVHLLNEAGFSKHTVKNIKTIEFVIEAYP*
Physicochemical properties
Number of amino acids:		216
Molecular weight:		23,824.236
Theoretical pI:		5.534
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34950 35075
Instability index:		20.368
aromaticity		0.093
GRAVY		-0.027
Secondary Structure Fraction
Helix		0.306
turn		0.208
sheet		0.292