Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332633.1 | internal | 239 | 3-719(+) |
Amino Acid sequence : | |||
KDGRKKSTAETWLLDLVHSKNSAILAGCRALKVISNKENGRKRATGVSFAFKTAGGGEEIGVVEARVVVAAAGAICTPPLLKRSGLKNPNIGRNLHVHPVVMGWGYFPNSWPEPEKKSYE GGIMTAMSKVAANFESSGYGAVIQTPALHPGMFSALMPWMSGADIKIRMLKFSRTAHVFALARDRGSGSIASESNISYKVAKTDEESLMEGMERVLRILAAAGAEEIGTHHKTGKVLRV | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,631.367 | ||
Theoretical pI: | 9.822 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 37.018 | ||
aromaticity | 0.063 | ||
GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.268 | ||
sheet | 0.293 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332633.1 | internal | 239 | 3-719(+) |
Amino Acid sequence : | |||
KDGRKKSTAETWLLDLVHSKNSAILAGCRALKVISNKENGRKRATGVSFAFKTAGGGEEIGVVEARVVVAAAGAICTPPLLKRSGLKNPNIGRNLHVHPVVMGWGYFPNSWPEPEKKSYE GGIMTAMSKVAANFESSGYGAVIQTPALHPGMFSALMPWMSGADIKIRMLKFSRTAHVFALARDRGSGSIASESNISYKVAKTDEESLMEGMERVLRILAAAGAEEIGTHHKTGKVLRV | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 25,631.367 | ||
Theoretical pI: | 9.822 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 37.018 | ||
aromaticity | 0.063 | ||
GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.268 | ||
sheet | 0.293 |