| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332633.1 | internal | 239 | 3-719(+) |
Amino Acid sequence : | |||
| KDGRKKSTAETWLLDLVHSKNSAILAGCRALKVISNKENGRKRATGVSFAFKTAGGGEEIGVVEARVVVAAAGAICTPPLLKRSGLKNPNIGRNLHVHPVVMGWGYFPNSWPEPEKKSYE GGIMTAMSKVAANFESSGYGAVIQTPALHPGMFSALMPWMSGADIKIRMLKFSRTAHVFALARDRGSGSIASESNISYKVAKTDEESLMEGMERVLRILAAAGAEEIGTHHKTGKVLRV | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 25,631.367 | ||
| Theoretical pI: | 9.822 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 37.018 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332633.1 | internal | 239 | 3-719(+) |
Amino Acid sequence : | |||
| KDGRKKSTAETWLLDLVHSKNSAILAGCRALKVISNKENGRKRATGVSFAFKTAGGGEEIGVVEARVVVAAAGAICTPPLLKRSGLKNPNIGRNLHVHPVVMGWGYFPNSWPEPEKKSYE GGIMTAMSKVAANFESSGYGAVIQTPALHPGMFSALMPWMSGADIKIRMLKFSRTAHVFALARDRGSGSIASESNISYKVAKTDEESLMEGMERVLRILAAAGAEEIGTHHKTGKVLRV | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 25,631.367 | ||
| Theoretical pI: | 9.822 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 37.018 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.268 | ||
| sheet | 0.293 | ||