| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332635.1 | internal | 211 | 2-634(+) |
Amino Acid sequence : | |||
| GFVAFSTPDEASRAIADMNGTMVISKPLYVALAQRKEDRRARLQAQFLQMRPVAMPPSMAPRMPIYPPGAPGIGQQLFYGQAPAMIPPQGGFGYQQQLVPGMRPGGAPMPNFFMPMVQQG QQGQRPGGRRGGPAQQNQQPVPMMQQQMLPRGRMYRYPPGRNAPEMPLPGVAGGMLSVPYDMGGMLPRDAAIPQPLPITALASALANATPE | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 22,692.270 | ||
| Theoretical pI: | 10.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 64.152 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.332 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332635.1 | internal | 211 | 2-634(+) |
Amino Acid sequence : | |||
| GFVAFSTPDEASRAIADMNGTMVISKPLYVALAQRKEDRRARLQAQFLQMRPVAMPPSMAPRMPIYPPGAPGIGQQLFYGQAPAMIPPQGGFGYQQQLVPGMRPGGAPMPNFFMPMVQQG QQGQRPGGRRGGPAQQNQQPVPMMQQQMLPRGRMYRYPPGRNAPEMPLPGVAGGMLSVPYDMGGMLPRDAAIPQPLPITALASALANATPE | |||
Physicochemical properties | |||
| Number of amino acids: | 211 | ||
| Molecular weight: | 22,692.270 | ||
| Theoretical pI: | 10.642 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 64.152 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.362 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.332 | ||
| sheet | 0.284 | ||