| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332642.1 | complete | 174 | 184-708(+) |
Amino Acid sequence : | |||
| MRTSKGNTAFLLRVEAQHNKRNVKSPKIKPQKSRDLSPSLGYHSRDEVLVPDLAIGSDIHLADPLIELRRLQFLPDAGEDVPEIRNDDVSGRVLVDHLERVAQLAIERLRLQMLGHEIEE PLEVERRGELLLGDDRLELRLRRVSAKRAHQNSELRRRNLAVAVGVEQRECLHR* | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 14,043.698 | ||
| Theoretical pI: | 9.430 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 66.040 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.412 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332642.1 | complete | 146 | 738-298(-) |
Amino Acid sequence : | |||
| MGKDLSDDQVSSMEAFTLFDTDGDGKIAPSELGILMRSLGGNPTQAQLKSIIAEEKLTAPFDFQRFLDLMSKHLKPEPFDRQLRDAFKVIDKDATGYVVVSDLRHILTSIGEKLEPAEFD EWIREVDVGSDGKIRYEDFIARMVAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 14,043.698 | ||
| Theoretical pI: | 9.430 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 66.040 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.412 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332642.1 | complete | 131 | 320-715(+) |
Amino Acid sequence : | |||
| MKSSYRILPSDPTSTSRIHSSNSAGSNFSPMLVRMCLRSETTTYPVASLSITLNASRSWRSNGSGFKCLDMRSRNLWKSNGAVSFSSAMIDLSCACVGFPPSERIRIPSSDGAILPSPSV SNSVNASIDET* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,043.698 | ||
| Theoretical pI: | 9.430 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 66.040 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.412 | ||
| sheet | 0.191 | ||