Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332649.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
IQSKQITMPRRSSGRSSRPAPRPAARSPPPQTASHAPPPAPVQGGSGGSILGGIGSTIAQGMAFGTGSAVAHRAVDAVMGPRVIQHETVASESAAAPAPAAPSMGGSDACSVHSKAFQDC LNGYGNDISKCQFYMDMLAECRRNSGSMMSS* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 15,310.101 | ||
Theoretical pI: | 9.432 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 83.623 | ||
aromaticity | 0.033 | ||
GRAVY | -0.298 | ||
Secondary Structure Fraction | |||
Helix | 0.146 | ||
turn | 0.377 | ||
sheet | 0.238 |