| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332653.1 | internal | 227 | 2-682(+) |
Amino Acid sequence : | |||
| LTRANYLASPPLVMAYALAGTVDIDFEKEPIGIGKDGKNVYFRDIWPSSEEIAQVVQSSVLPEMFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKD AYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVYDAATRYQSDGQDTIVIA | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,079.987 | ||
| Theoretical pI: | 5.611 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 41.871 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332653.1 | internal | 227 | 2-682(+) |
Amino Acid sequence : | |||
| LTRANYLASPPLVMAYALAGTVDIDFEKEPIGIGKDGKNVYFRDIWPSSEEIAQVVQSSVLPEMFKSTYEAITKGNEFWNQLSVPSSSLYEWDPKSTYIHKPPYFSGMTMDPPGPRGAKD AYCLLLFGDSITTDHISPAGSIHKDSPAAKYLMERGVDRKDFNSYGSRRGNDEVMARGTFANIRIVNKLLNGEVGPKTIHIPSGEKLSVYDAATRYQSDGQDTIVIA | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,079.987 | ||
| Theoretical pI: | 5.611 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34380 | ||
| Instability index: | 41.871 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.392 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.216 | ||