| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332654.1 | 5prime_partial | 136 | 3-413(+) |
Amino Acid sequence : | |||
| GYKLVSGGSDNHLVLVDLRPLGIDGARVEKILDMASITLNKNSVPGDKSALVPGGIRIGSPAMTTRGFSESEFVSVADFIHEGVQIALDAKKAVSGTKLQDFMKFVTSPSFPLIDRVSEL QRRVEALTTQFPIPGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,552.595 | ||
| Theoretical pI: | 6.946 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 38.799 | ||
| aromaticity | 0.059 | ||
| GRAVY | 0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.272 | ||
| sheet | 0.235 | ||