| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332657.1 | complete | 180 | 67-609(+) |
Amino Acid sequence : | |||
| MKFLLLQIWQWPRIFRVDYGHQEASTKFGKDPRSYEVLTKQFIGDENGSVRGLEIVRVKWEKDESGRFQFKEVEGSEEIIDADLVMLAMGFLGPEETLADKLGLEKDNRSNFKAEYGRFS TNVEGVFAAGDCRRGQSLVVWAISEGRQAAAQVDKYLMKDGEDEEVSKQQQDSQIQTVRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 180 | ||
| Molecular weight: | 13,370.924 | ||
| Theoretical pI: | 9.739 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 64.280 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.390 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332657.1 | complete | 123 | 539-168(-) |
Amino Acid sequence : | |||
| MRYLSTWAAACLPSEIAHTTRDCPRRQSPAANTPSTLVEKRPYSALKFDRLSFSNPSLSASVSSGPRNPMASMTRSASMISSEPSTSLNWNLPLSSFSHLTRTISSPLTDPFSSPINCFV NTS* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,370.924 | ||
| Theoretical pI: | 9.739 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 64.280 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.220 | ||
| turn | 0.390 | ||
| sheet | 0.228 | ||