| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332673.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| SNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKG ETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAXHVND SVTKSKFDNLYGCPHSLPDGLMRATDVMI | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 27,471.631 | ||
| Theoretical pI: | 5.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.832 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.289 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332673.1 | 5prime_partial | 264 | 808-14(-) |
Amino Acid sequence : | |||
| NHYISSPHKSIRQRVRASVQVIELALGDGIIDMXGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGIT AVVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGL GHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 27,471.631 | ||
| Theoretical pI: | 5.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.832 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.289 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332673.1 | internal | 269 | 2-808(+) |
Amino Acid sequence : | |||
| SNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKG ETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKADPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAXHVND SVTKSKFDNLYGCPHSLPDGLMRATDVMI | |||
Physicochemical properties | |||
| Number of amino acids: | 269 | ||
| Molecular weight: | 27,471.631 | ||
| Theoretical pI: | 5.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.832 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.289 | ||
| sheet | 0.316 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332673.1 | 5prime_partial | 264 | 808-14(-) |
Amino Acid sequence : | |||
| NHYISSPHKSIRQRVRASVQVIELALGDGIIDMXGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRFDALVNQQRGIT AVVDDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGL GHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 264 | ||
| Molecular weight: | 27,471.631 | ||
| Theoretical pI: | 5.147 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.832 | ||
| aromaticity | 0.027 | ||
| GRAVY | -0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.289 | ||
| sheet | 0.316 | ||