| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332687.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
| PFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRHSLPDGLMRATD | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 27,118.409 | ||
| Theoretical pI: | 5.383 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.689 | ||
| aromaticity | 0.011 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332687.1 | 5prime_partial | 261 | 810-25(-) |
Amino Acid sequence : | |||
| ISSPHKSIRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHALVDQQSGITAVV HDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHV LDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 27,118.409 | ||
| Theoretical pI: | 5.383 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.689 | ||
| aromaticity | 0.011 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332687.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
| PFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRHSLPDGLMRATD | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 27,118.409 | ||
| Theoretical pI: | 5.383 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.689 | ||
| aromaticity | 0.011 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.322 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332687.1 | 5prime_partial | 261 | 810-25(-) |
Amino Acid sequence : | |||
| ISSPHKSIRQRVPATIQVIELALGDRIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHALVDQQSGITAVV HDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHV LDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 27,118.409 | ||
| Theoretical pI: | 5.383 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 45.689 | ||
| aromaticity | 0.011 | ||
| GRAVY | 0.033 | ||
Secondary Structure Fraction | |||
| Helix | 0.307 | ||
| turn | 0.284 | ||
| sheet | 0.322 | ||