Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332688.1 | 5prime_partial | 169 | 750-241(-) |
Amino Acid sequence : | |||
ALAPDVASALWVSNLLLMISVGQARSATASPAPAPQTPCWFTVRGAPGADLKLASTWPRTVTSTALKAATVARVAPMPLYNPLGPSAAIVCFTASIAPEYFGARPGSGAGWLWSFTSMVS NGCPHISCAAPPTVPAARSFAPSPIYTRPPQIPDESFNRRTTKKTRNAM* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 11,672.205 | ||
Theoretical pI: | 8.996 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28835 | ||
Instability index: | 58.506 | ||
aromaticity | 0.086 | ||
GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
Helix | 0.171 | ||
turn | 0.314 | ||
sheet | 0.162 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332688.1 | complete | 109 | 317-646(+) |
Amino Acid sequence : | |||
MGDGAKDLAAGTVGGAAQLICGHPFDTIEVKLQSQPAPLPGRAPKYSGAIDAVKQTIAAEGPRGLYKGMGATLATVAAFNAVLVTVRGQVEANLRSAPGAPLTVNQQGV* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,672.205 | ||
Theoretical pI: | 8.996 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28835 | ||
Instability index: | 58.506 | ||
aromaticity | 0.086 | ||
GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
Helix | 0.171 | ||
turn | 0.314 | ||
sheet | 0.162 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332688.1 | complete | 105 | 376-693(+) |
Amino Acid sequence : | |||
MWAPIRHHRGEAPKPTCSASWAGSKIFGCYRCCEANYSCRRSEGVVQGHGSHSCYCGSLQCCARHCSRPSGSQLEVCPRCSSYGEPTRCLRRWSWTRCGASCLPH* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,672.205 | ||
Theoretical pI: | 8.996 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28835 | ||
Instability index: | 58.506 | ||
aromaticity | 0.086 | ||
GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
Helix | 0.171 | ||
turn | 0.314 | ||
sheet | 0.162 |