| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332688.1 | 5prime_partial | 169 | 750-241(-) |
Amino Acid sequence : | |||
| ALAPDVASALWVSNLLLMISVGQARSATASPAPAPQTPCWFTVRGAPGADLKLASTWPRTVTSTALKAATVARVAPMPLYNPLGPSAAIVCFTASIAPEYFGARPGSGAGWLWSFTSMVS NGCPHISCAAPPTVPAARSFAPSPIYTRPPQIPDESFNRRTTKKTRNAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 11,672.205 | ||
| Theoretical pI: | 8.996 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28835 | ||
| Instability index: | 58.506 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
| Helix | 0.171 | ||
| turn | 0.314 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332688.1 | complete | 109 | 317-646(+) |
Amino Acid sequence : | |||
| MGDGAKDLAAGTVGGAAQLICGHPFDTIEVKLQSQPAPLPGRAPKYSGAIDAVKQTIAAEGPRGLYKGMGATLATVAAFNAVLVTVRGQVEANLRSAPGAPLTVNQQGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,672.205 | ||
| Theoretical pI: | 8.996 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28835 | ||
| Instability index: | 58.506 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
| Helix | 0.171 | ||
| turn | 0.314 | ||
| sheet | 0.162 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332688.1 | complete | 105 | 376-693(+) |
Amino Acid sequence : | |||
| MWAPIRHHRGEAPKPTCSASWAGSKIFGCYRCCEANYSCRRSEGVVQGHGSHSCYCGSLQCCARHCSRPSGSQLEVCPRCSSYGEPTRCLRRWSWTRCGASCLPH* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,672.205 | ||
| Theoretical pI: | 8.996 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28835 | ||
| Instability index: | 58.506 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
| Helix | 0.171 | ||
| turn | 0.314 | ||
| sheet | 0.162 | ||