| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332696.1 | 5prime_partial | 221 | 3-668(+) |
Amino Acid sequence : | |||
| NGVANQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCENIPI VLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLVAQQQHEAELAQAANQPLPDDDDEAFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 25,116.169 | ||
| Theoretical pI: | 6.415 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 26275 | ||
| Instability index: | 27.296 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.465 | ||
Secondary Structure Fraction | |||
| Helix | 0.312 | ||
| turn | 0.195 | ||
| sheet | 0.208 | ||