| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
| LCRSSALTHTQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSG SPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKVGALLLCDMAHISGLVAAQ EAADPFEYCDIVTTTTHKSLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
| SVALPHSHTHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPQRTSPPSPSSRPSAAPSPTSTPRACRATATTVATNSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAA LRPTSPPTPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFISRACLIRWIRRLDTSITSDWRRRRWISALN* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | 5prime_partial | 173 | 1-522(+) |
Amino Acid sequence : | |||
| SLSLFRTHTHTESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHAGQPLLRWQRIHRRDREPHALTRPPGLPPRPHPLGRQRPALQR LSGQLRRLHRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLFRELAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | 5prime_partial | 164 | 787-293(-) |
Amino Acid sequence : | |||
| TPQALVSCCCDDVAVLERIGCFLSSNESTNMRHITQQQSSNLISDLPKPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQALEINRGRTDLLPAGCVVSVGEVAAGGQ IEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | internal | 262 | 2-787(+) |
Amino Acid sequence : | |||
| LCRSSALTHTQRAKMDPVSEWGNSSLSAVDPEIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTRWGVNVQPYSG SPANFAAYTAVLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVDSKTGYIDYERLEEKALDFRPKLIICGGSAYPRDWDYKRFREIADKVGALLLCDMAHISGLVAAQ EAADPFEYCDIVTTTTHKSLRG | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | 5prime_partial | 197 | 3-596(+) |
Amino Acid sequence : | |||
| SVALPHSHTHRERKWIQSQSGATPRSPPWTPRSTTSSRRRSAANAAASSSSPQRTSPPSPSSRPSAAPSPTSTPRACRATATTVATNSSTRSRTSRAHAPSRPTASTPPAGASTSSPTAA LRPTSPPTPPSSTPTTASWASICPPAATSPTDTTHPAGRRSVRPRFISRACLIRWIRRLDTSITSDWRRRRWISALN* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | 5prime_partial | 173 | 1-522(+) |
Amino Acid sequence : | |||
| SLSLFRTHTHTESENGSSLRVGQLLALRRGPRDPRPHREGEAPPMPRHRAHRLRELHLLRRHRGPRQRPHQQVLRGHAGQPLLRWQRIHRRDREPHALTRPPGLPPRPHPLGRQRPALQR LSGQLRRLHRRPQPPRPHHGPRSALRRPPHPRILHIRREEDQCDLDLFRELAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332701.1 | 5prime_partial | 164 | 787-293(-) |
Amino Acid sequence : | |||
| TPQALVSCCCDDVAVLERIGCFLSSNESTNMRHITQQQSSNLISDLPKPLIIPIPRVRAPATYNQFRAEIQRLLLQSLVIDVSSLRIHLIRQALEINRGRTDLLPAGCVVSVGEVAAGGQ IEAHDAVVGVEDGGVGGEVGRRAAVGLDVDAPAGGVEAVGLEGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,170.415 | ||
| Theoretical pI: | 4.976 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
| Instability index: | 45.568 | ||
| aromaticity | 0.018 | ||
| GRAVY | 0.200 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.250 | ||
| sheet | 0.274 | ||