| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332717.1 | internal | 197 | 1-591(+) |
Amino Acid sequence : | |||
| LHRKFKMLQFSIQRVRNMRRLMSPGICGVVSSRFSTVAEPSWRHGNSLRVPNLIGGSFVDSHSSDTIDVINPATREVVSQVPLTTKEEFRSAVSAAKEAFPSWRNTPITTRQRIMFKLQE LIRKNMDKLAFNITTEQGKTLKDAQGDVFRGLEVVEHACGMATLQMGEYVSNVSTGIDTYSIREPLGVCAGICPFNF | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 13,855.967 | ||
| Theoretical pI: | 7.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 48.251 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332717.1 | complete | 124 | 377-3(-) |
Amino Acid sequence : | |||
| MFLRISSWSLNMMRCRVVIGVFRHDGKASFAADTADLNSSFVVSGTCETTSRVAGFMTSMVSDECESTKLPPIRFGTLRELPCLQDGSATVEKRELTTPHIPGLINLLIFLTRWIENCNI LNLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,855.967 | ||
| Theoretical pI: | 7.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 48.251 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332717.1 | internal | 197 | 1-591(+) |
Amino Acid sequence : | |||
| LHRKFKMLQFSIQRVRNMRRLMSPGICGVVSSRFSTVAEPSWRHGNSLRVPNLIGGSFVDSHSSDTIDVINPATREVVSQVPLTTKEEFRSAVSAAKEAFPSWRNTPITTRQRIMFKLQE LIRKNMDKLAFNITTEQGKTLKDAQGDVFRGLEVVEHACGMATLQMGEYVSNVSTGIDTYSIREPLGVCAGICPFNF | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 13,855.967 | ||
| Theoretical pI: | 7.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 48.251 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.258 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332717.1 | complete | 124 | 377-3(-) |
Amino Acid sequence : | |||
| MFLRISSWSLNMMRCRVVIGVFRHDGKASFAADTADLNSSFVVSGTCETTSRVAGFMTSMVSDECESTKLPPIRFGTLRELPCLQDGSATVEKRELTTPHIPGLINLLIFLTRWIENCNI LNLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,855.967 | ||
| Theoretical pI: | 7.653 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 48.251 | ||
| aromaticity | 0.073 | ||
| GRAVY | 0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.242 | ||
| sheet | 0.258 | ||