| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332724.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| RRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEALVAAAQLSYQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKA QISALIDKNKEMSKAESEAGDGGPVVTEVDIQHIVSSWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGCGKIRTCKSHGLLT | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,861.261 | ||
| Theoretical pI: | 7.932 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.668 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.634 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.177 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332724.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| RRFQPVKVPEPTVDETIQILKGLRERYEIHHKLRYTDEALVAAAQLSYQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKA QISALIDKNKEMSKAESEAGDGGPVVTEVDIQHIVSSWTGIPVEKVSTDESDRLLKMEETLHKRVIGQDEAVKAISRAIRRARVGLKNPNRPIASFIFSGPTGCGKIRTCKSHGLLT | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,861.261 | ||
| Theoretical pI: | 7.932 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 40.668 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.634 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.177 | ||
| sheet | 0.283 | ||