| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332730.1 | 3prime_partial | 188 | 160-723(+) |
Amino Acid sequence : | |||
| MWEEEMDLVVHDLRNDMRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAXN GEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKICDEIS | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 15,428.597 | ||
| Theoretical pI: | 5.880 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 55.594 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.223 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332730.1 | complete | 140 | 531-109(-) |
Amino Acid sequence : | |||
| MLFSVXSHYFPSLLDIIIVEKCKPSALQVSAFSKVALQERPEQGDEIAVVVIEALRQSAALRVELGGLDEQRISLRLEFGIKHHPVHDVIEHELQPPPNNQPFLSDPHVISQVVDDEVHL LLPHPAVVVHHLVGKKRGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,428.597 | ||
| Theoretical pI: | 5.880 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 55.594 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.223 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332730.1 | 3prime_partial | 188 | 160-723(+) |
Amino Acid sequence : | |||
| MWEEEMDLVVHDLRNDMRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQTDPLFVQATKFNSERSRLAQSFDYNYGDFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAXN GEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKICDEIS | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 15,428.597 | ||
| Theoretical pI: | 5.880 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 55.594 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.223 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332730.1 | complete | 140 | 531-109(-) |
Amino Acid sequence : | |||
| MLFSVXSHYFPSLLDIIIVEKCKPSALQVSAFSKVALQERPEQGDEIAVVVIEALRQSAALRVELGGLDEQRISLRLEFGIKHHPVHDVIEHELQPPPNNQPFLSDPHVISQVVDDEVHL LLPHPAVVVHHLVGKKRGGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,428.597 | ||
| Theoretical pI: | 5.880 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 55.594 | ||
| aromaticity | 0.043 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.360 | ||
| turn | 0.223 | ||
| sheet | 0.266 | ||