Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332731.1 | 5prime_partial | 212 | 3-641(+) |
Amino Acid sequence : | |||
LDILKLMSSTYLIALCQAIDLRHLEENLKHAVKNTLSQVAKRTLTMGANGELHPSRFCEKDLIRVVDREYVFAYIDDPCSATYPLMQKLRQVLVDHALKNGENEKNVGTSIFHKIEAFEE ELKALLPKEVESARVALESGNPAVANRIAECRSYPLYKFIREELGTSFLTGEKVISPGEECERVFTALSKGLIVDPLLECLQGWNGAPLPIC* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 23,745.196 | ||
Theoretical pI: | 5.633 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 37.780 | ||
aromaticity | 0.066 | ||
GRAVY | -0.107 | ||
Secondary Structure Fraction | |||
Helix | 0.325 | ||
turn | 0.198 | ||
sheet | 0.335 |