| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332734.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| KEVELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPL YLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 14,198.842 | ||
| Theoretical pI: | 11.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 72.400 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.780 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332734.1 | complete | 125 | 417-40(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,198.842 | ||
| Theoretical pI: | 11.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 72.400 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.780 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332734.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| KEVELHAQAWDHALSYITPTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSNDCYAQSPLSRVFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTPL YLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFESLPKADAVMLMWVLHDWS | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 14,198.842 | ||
| Theoretical pI: | 11.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 72.400 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.780 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332734.1 | complete | 125 | 417-40(-) |
Amino Acid sequence : | |||
| MEAVGRVIPRILTSDRLQIEGCPRFQGFAAQARRRPRYRRRLHQHVGSQILSRENPRKRRLGVTVVGFGEDAVEDEESHEAVEWLTGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GGDVT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,198.842 | ||
| Theoretical pI: | 11.358 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 72.400 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.780 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||