| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332751.1 | 5prime_partial | 202 | 836-228(-) |
Amino Acid sequence : | |||
| KRGKLRSDMTVEERISAADRRKMDGNALFKEEELEAAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLIKLNRYGEAIAQCSIVLMEDENNVKALFRRGKARAELGQVD AAREDFLKARKYAPEDKAIQKELRLLAEHDKAVYQKQKELYKGLFGKPPEPKSSPKNWLILFWKWLVSIFYRIFKKQRQKND* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 14,078.239 | ||
| Theoretical pI: | 5.609 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 56.188 | ||
| aromaticity | 0.149 | ||
| GRAVY | 0.560 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.140 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332751.1 | complete | 121 | 390-755(+) |
Amino Acid sequence : | |||
| MFCEQPQLFLYCFVFWGVFTSLEEVFTSSIHLPQLCSSFATSKQCFHIVFILHQDNATLGNGFTVAVEFYQACRHVEVTRILYCQSHITVLPEQLEHEVISHICYGHFILLHCCLQFLLL E* | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 14,078.239 | ||
| Theoretical pI: | 5.609 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
| Instability index: | 56.188 | ||
| aromaticity | 0.149 | ||
| GRAVY | 0.560 | ||
Secondary Structure Fraction | |||
| Helix | 0.430 | ||
| turn | 0.140 | ||
| sheet | 0.248 | ||