Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332751.1 | 5prime_partial | 202 | 836-228(-) |
Amino Acid sequence : | |||
KRGKLRSDMTVEERISAADRRKMDGNALFKEEELEAAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAACLIKLNRYGEAIAQCSIVLMEDENNVKALFRRGKARAELGQVD AAREDFLKARKYAPEDKAIQKELRLLAEHDKAVYQKQKELYKGLFGKPPEPKSSPKNWLILFWKWLVSIFYRIFKKQRQKND* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 14,078.239 | ||
Theoretical pI: | 5.609 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
Instability index: | 56.188 | ||
aromaticity | 0.149 | ||
GRAVY | 0.560 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.140 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332751.1 | complete | 121 | 390-755(+) |
Amino Acid sequence : | |||
MFCEQPQLFLYCFVFWGVFTSLEEVFTSSIHLPQLCSSFATSKQCFHIVFILHQDNATLGNGFTVAVEFYQACRHVEVTRILYCQSHITVLPEQLEHEVISHICYGHFILLHCCLQFLLL E* | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 14,078.239 | ||
Theoretical pI: | 5.609 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
Instability index: | 56.188 | ||
aromaticity | 0.149 | ||
GRAVY | 0.560 | ||
Secondary Structure Fraction | |||
Helix | 0.430 | ||
turn | 0.140 | ||
sheet | 0.248 |