| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332756.1 | complete | 163 | 49-540(+) |
Amino Acid sequence : | |||
| MLSFTKTFISFPPHFPCAVQNLSTRSFTLIRSSSDDGNINESISSQQSPPAITPPDSVEIRFKRGSRRRRKQREEEEGGFGDRTAASKKAAPVAKDWESMSLSEKAVELYMGEKGMLFWL NKFAYASIFIVIGGWILFRFVGPSLNLYQLDTPPLAPTSMFKG* | |||
Physicochemical properties | |||
| Number of amino acids: | 163 | ||
| Molecular weight: | 17,596.087 | ||
| Theoretical pI: | 11.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 87.486 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.964 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.284 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332756.1 | 5prime_partial | 148 | 663-217(-) |
Amino Acid sequence : | |||
| RTKSNFSSTLCCKTSKVYQQNIRTDYKPYQQLSYNRLMDQNLALEHGSRSKRRSIKLIQIERRSNKSEQNPSPNHNKNGSIRKLVEPEKHTLLPHVKLHRLLAQTHRFPILRNWRRLFRR RRSISESPLLLLPLLPPPSRSAFESNLY* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 17,596.087 | ||
| Theoretical pI: | 11.249 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
| Instability index: | 87.486 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.964 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.284 | ||
| sheet | 0.216 | ||