| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332763.1 | complete | 156 | 450-920(+) |
Amino Acid sequence : | |||
| MSVITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVSLTDINLDPTTAKI TFKSIAGLSRTFPVDAFVVEEKVNTTAGSGDVVKEV* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 12,667.413 | ||
| Theoretical pI: | 9.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 58.276 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.716 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.214 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332763.1 | 5prime_partial | 112 | 2-340(+) |
Amino Acid sequence : | |||
| YVKPKHEVNPQMTLRRLPDEDPQNLADPAYRRRRIIMQNMRDEELAIAQVEEMQAVSAVLKGKYTMTGEAFDPVEVDMGAVRRITSRSPAARSGASVTSPRMTRPTISKPTR* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,667.413 | ||
| Theoretical pI: | 9.973 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
| Instability index: | 58.276 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.716 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.214 | ||
| sheet | 0.277 | ||