| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332768.1 | 5prime_partial | 232 | 2-700(+) |
Amino Acid sequence : | |||
| LEACKNADPQPSIVWASSSSVYGLNEKVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVK GCLGSLDTAKKSTGSGGKKRGPAQFRIFNLGNTSPVTVPMMVGMLEKHLKVKAKKNVVEMPGNGDVPFTHANISYARREFGYRPTTDLQTGLKKFVKWYLSYYGYNHRNSVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 12,092.723 | ||
| Theoretical pI: | 9.480 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 72.545 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.267 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332768.1 | complete | 105 | 505-188(-) |
Amino Acid sequence : | |||
| MLLQHPHHHRHRHGRRIPQIEDPELGRAPFLPARTRALLRRIQRPQAPLHDIINVCEIPGQIHPVLAPVYGDRFPLQNIPCEREISHVGSAPWPVNGEESQPGYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,092.723 | ||
| Theoretical pI: | 9.480 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 72.545 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.267 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332768.1 | 5prime_partial | 232 | 2-700(+) |
Amino Acid sequence : | |||
| LEACKNADPQPSIVWASSSSVYGLNEKVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVK GCLGSLDTAKKSTGSGGKKRGPAQFRIFNLGNTSPVTVPMMVGMLEKHLKVKAKKNVVEMPGNGDVPFTHANISYARREFGYRPTTDLQTGLKKFVKWYLSYYGYNHRNSVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 12,092.723 | ||
| Theoretical pI: | 9.480 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 72.545 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.267 | ||
| sheet | 0.219 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332768.1 | complete | 105 | 505-188(-) |
Amino Acid sequence : | |||
| MLLQHPHHHRHRHGRRIPQIEDPELGRAPFLPARTRALLRRIQRPQAPLHDIINVCEIPGQIHPVLAPVYGDRFPLQNIPCEREISHVGSAPWPVNGEESQPGYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,092.723 | ||
| Theoretical pI: | 9.480 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 72.545 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.267 | ||
| sheet | 0.219 | ||