Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332768.1 | 5prime_partial | 232 | 2-700(+) |
Amino Acid sequence : | |||
LEACKNADPQPSIVWASSSSVYGLNEKVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVK GCLGSLDTAKKSTGSGGKKRGPAQFRIFNLGNTSPVTVPMMVGMLEKHLKVKAKKNVVEMPGNGDVPFTHANISYARREFGYRPTTDLQTGLKKFVKWYLSYYGYNHRNSVK* | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 12,092.723 | ||
Theoretical pI: | 9.480 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 72.545 | ||
aromaticity | 0.048 | ||
GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.267 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332768.1 | complete | 105 | 505-188(-) |
Amino Acid sequence : | |||
MLLQHPHHHRHRHGRRIPQIEDPELGRAPFLPARTRALLRRIQRPQAPLHDIINVCEIPGQIHPVLAPVYGDRFPLQNIPCEREISHVGSAPWPVNGEESQPGYR* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,092.723 | ||
Theoretical pI: | 9.480 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 72.545 | ||
aromaticity | 0.048 | ||
GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.267 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332768.1 | 5prime_partial | 232 | 2-700(+) |
Amino Acid sequence : | |||
LEACKNADPQPSIVWASSSSVYGLNEKVPFSESDRTDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNILQGKPITIYRGKNRVDLARDFTYIDDIVK GCLGSLDTAKKSTGSGGKKRGPAQFRIFNLGNTSPVTVPMMVGMLEKHLKVKAKKNVVEMPGNGDVPFTHANISYARREFGYRPTTDLQTGLKKFVKWYLSYYGYNHRNSVK* | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 12,092.723 | ||
Theoretical pI: | 9.480 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 72.545 | ||
aromaticity | 0.048 | ||
GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.267 | ||
sheet | 0.219 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332768.1 | complete | 105 | 505-188(-) |
Amino Acid sequence : | |||
MLLQHPHHHRHRHGRRIPQIEDPELGRAPFLPARTRALLRRIQRPQAPLHDIINVCEIPGQIHPVLAPVYGDRFPLQNIPCEREISHVGSAPWPVNGEESQPGYR* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,092.723 | ||
Theoretical pI: | 9.480 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 72.545 | ||
aromaticity | 0.048 | ||
GRAVY | -0.683 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.267 | ||
sheet | 0.219 |