| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332779.1 | 5prime_partial | 204 | 3-617(+) |
Amino Acid sequence : | |||
| QVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVG NLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 14,629.837 | ||
| Theoretical pI: | 10.570 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.912 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.257 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332779.1 | 5prime_partial | 136 | 620-210(-) |
Amino Acid sequence : | |||
| SSSSTSGEQATITHLCLNFITGTLAGHVIHRLQSSRTYLPVRAVVVNHHMVILLKRPGRLRPAVCHAARCTDITAGGIAAHQPVKIPHANPAGCLLREDKLTTVNNPRWLIFAAGSRKSS GCKMEFRRSGLNGCTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,629.837 | ||
| Theoretical pI: | 10.570 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.912 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.257 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332779.1 | 5prime_partial | 204 | 3-617(+) |
Amino Acid sequence : | |||
| QVKSAATQTFDGIAQNMAAMLTGSEQNWRSFTRSVLSMMTEILLKQAMVGIVGSIGSAIGGAVGGGASASGGTAIQAAAAKFHFATGGFTGTGGKYEPAGIVHRGEFVFTKEATSRIGVG NLYRLMRGYATGGYVGTPGSMADSRSQASGTFEQNNHVVINNDGTNGQIGPAALKAVYDMARKGARDEIQTQMRDGGLFSGGGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 14,629.837 | ||
| Theoretical pI: | 10.570 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.912 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.257 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332779.1 | 5prime_partial | 136 | 620-210(-) |
Amino Acid sequence : | |||
| SSSSTSGEQATITHLCLNFITGTLAGHVIHRLQSSRTYLPVRAVVVNHHMVILLKRPGRLRPAVCHAARCTDITAGGIAAHQPVKIPHANPAGCLLREDKLTTVNNPRWLIFAAGSRKSS GCKMEFRRSGLNGCTA* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,629.837 | ||
| Theoretical pI: | 10.570 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.912 | ||
| aromaticity | 0.037 | ||
| GRAVY | -0.050 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.257 | ||
| sheet | 0.235 | ||