| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332783.1 | internal | 286 | 3-860(+) |
Amino Acid sequence : | |||
| CLNRELLNDPAFEWTDGSRQWVERMLDYNVPGGKLNRGLSVIDSYKLLKEGKDLSEKEVFLASALGWCIEWLQAYFLVLDDIMDNSHTRRGQPCWFRILKVGMIAVNDGIILRNHIPRIL KNHFRDKPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSLPLHRRIVQYKTAYYSFYLPVACALLMAGENLEKHTLVRDVLIDMGIYFQVQDDYLDCFGEPEKIGKIGTDIED FKCSWLVVKALELCNEEQKTTLFDHYGEEDPADVAKIKALYNEINL | |||
Physicochemical properties | |||
| Number of amino acids: | 286 | ||
| Molecular weight: | 12,286.334 | ||
| Theoretical pI: | 8.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 55.032 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
| Helix | 0.452 | ||
| turn | 0.163 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332783.1 | 5prime_partial | 104 | 860-546(-) |
Amino Acid sequence : | |||
| EIDFVVEGLDFCNISWILLSVVIEKSCLLFFVAKFQGLHNQPRTFEIFNICSNLPNLFRLTEAIQVVILYLKVYSHINKHISHKCVFLQVLTRHEQRTSHWKVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,286.334 | ||
| Theoretical pI: | 8.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 55.032 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
| Helix | 0.452 | ||
| turn | 0.163 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332783.1 | internal | 286 | 3-860(+) |
Amino Acid sequence : | |||
| CLNRELLNDPAFEWTDGSRQWVERMLDYNVPGGKLNRGLSVIDSYKLLKEGKDLSEKEVFLASALGWCIEWLQAYFLVLDDIMDNSHTRRGQPCWFRILKVGMIAVNDGIILRNHIPRIL KNHFRDKPYYVDLLDLFNEVEFQTASGQMIDLITTIEGEKDLSKYSLPLHRRIVQYKTAYYSFYLPVACALLMAGENLEKHTLVRDVLIDMGIYFQVQDDYLDCFGEPEKIGKIGTDIED FKCSWLVVKALELCNEEQKTTLFDHYGEEDPADVAKIKALYNEINL | |||
Physicochemical properties | |||
| Number of amino acids: | 286 | ||
| Molecular weight: | 12,286.334 | ||
| Theoretical pI: | 8.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 55.032 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
| Helix | 0.452 | ||
| turn | 0.163 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332783.1 | 5prime_partial | 104 | 860-546(-) |
Amino Acid sequence : | |||
| EIDFVVEGLDFCNISWILLSVVIEKSCLLFFVAKFQGLHNQPRTFEIFNICSNLPNLFRLTEAIQVVILYLKVYSHINKHISHKCVFLQVLTRHEQRTSHWKVK* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 12,286.334 | ||
| Theoretical pI: | 8.800 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 55.032 | ||
| aromaticity | 0.125 | ||
| GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
| Helix | 0.452 | ||
| turn | 0.163 | ||
| sheet | 0.202 | ||