| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332788.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| IFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDALYESSLVRKEDVPDVVHLTHLTTPESIFHLRLGFAHFASQPYISKWYLWLMWPLTVWSMMITWIYGRTFVVERN IFKNLKLQTWALPKYTIQYYMQWQREWINNLIEDAIVEADAKGVKVLSLGLLNQEEGLNRNGEIFLRRNPQLKVKLVDGSSLAVAIVLNSIPKGTTQVVLRGNITKVAYSIALALCQDGK FQVYTLNEDDYKKLKV | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,930.349 | ||
| Theoretical pI: | 9.058 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 69330 69330 | ||
| Instability index: | 28.439 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.195 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332788.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| IFPPLKYLIYTPSYHSLHHTQFRTNYSLFMPFYDYVYGTMDKSSDALYESSLVRKEDVPDVVHLTHLTTPESIFHLRLGFAHFASQPYISKWYLWLMWPLTVWSMMITWIYGRTFVVERN IFKNLKLQTWALPKYTIQYYMQWQREWINNLIEDAIVEADAKGVKVLSLGLLNQEEGLNRNGEIFLRRNPQLKVKLVDGSSLAVAIVLNSIPKGTTQVVLRGNITKVAYSIALALCQDGK FQVYTLNEDDYKKLKV | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,930.349 | ||
| Theoretical pI: | 9.058 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 69330 69330 | ||
| Instability index: | 28.439 | ||
| aromaticity | 0.141 | ||
| GRAVY | -0.088 | ||
Secondary Structure Fraction | |||
| Helix | 0.406 | ||
| turn | 0.195 | ||
| sheet | 0.238 | ||