| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332794.1 | complete | 244 | 71-805(+) |
Amino Acid sequence : | |||
| MGAGGRMSVPPEGKKVKSEVLQRVPFTKPPFTLGDVKKAIPPHCFKRSVLRSFSYVLYDLVIASLFYYIATNYFPQLPHPLPYLAWPLYWICQGCILTGVWVIAHECGHHAFSDYQWLDD TVGLILHSFLLVPFFSWKYSHRRHHSNTGSLERDEVFVPKKKSELSWSAKYLNNPPGRVFSLVVQLTLGWPMYLMLNVSGRPYDRFACHFDPHSPIYSERERAQIVISDLGHSCCNIRVY IVLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 14,392.555 | ||
| Theoretical pI: | 10.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 76.840 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332794.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
| LSSSHYILPTRRDKPFSLLRSLNNGCWRANVRASRGQEGQIGGPPTRSIHKATIHPRRCKESYSTPLFQAICSSFLFLCPVRPRDRLSVLLHCHKLFPTTPSPSPLPSLATLLDMPRLHS NWCLGHSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,392.555 | ||
| Theoretical pI: | 10.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 76.840 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332794.1 | complete | 244 | 71-805(+) |
Amino Acid sequence : | |||
| MGAGGRMSVPPEGKKVKSEVLQRVPFTKPPFTLGDVKKAIPPHCFKRSVLRSFSYVLYDLVIASLFYYIATNYFPQLPHPLPYLAWPLYWICQGCILTGVWVIAHECGHHAFSDYQWLDD TVGLILHSFLLVPFFSWKYSHRRHHSNTGSLERDEVFVPKKKSELSWSAKYLNNPPGRVFSLVVQLTLGWPMYLMLNVSGRPYDRFACHFDPHSPIYSERERAQIVISDLGHSCCNIRVY IVLL* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 14,392.555 | ||
| Theoretical pI: | 10.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 76.840 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332794.1 | 5prime_partial | 128 | 1-387(+) |
Amino Acid sequence : | |||
| LSSSHYILPTRRDKPFSLLRSLNNGCWRANVRASRGQEGQIGGPPTRSIHKATIHPRRCKESYSTPLFQAICSSFLFLCPVRPRDRLSVLLHCHKLFPTTPSPSPLPSLATLLDMPRLHS NWCLGHSP* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,392.555 | ||
| Theoretical pI: | 10.561 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
| Instability index: | 76.840 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.328 | ||
| sheet | 0.203 | ||