| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332798.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| NSLIVIMPESLPSFSTSVKLKYVKQGYQYLVNHILTFTLIPIVVAVAVQLLRLGPHEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSR LILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSSIDSLMQKTGIRPKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNIKSYNLSG | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 14,880.468 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 92.991 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.815 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.252 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332798.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| KFTHRHHAGIPPQFLHLRQAQVCKTRLPIPCQPHPHLHPHPHRRRRRRPAPPIRPPRNARHLELPPIGRSPPPLLLLPRRLRRHRLLHVQAQVDLPRGLRLLQAACHVPRPLLHLHGAFP PHSQRQP* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,880.468 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 92.991 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.815 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.252 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332798.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| NSLIVIMPESLPSFSTSVKLKYVKQGYQYLVNHILTFTLIPIVVAVAVQLLRLGPHEMLAIWNSLQLDALHLLCCFFLVVFVATVYFMSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSR LILKDNPKSVDFQMRILERSGLGEETCLPPAIHYIPPTPTMEAARGEAEVVIFSSIDSLMQKTGIRPKDIDILIVNCSLFSPTPSLSAMIVNKYKLRSNIKSYNLSG | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 14,880.468 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 92.991 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.815 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.252 | ||
| sheet | 0.228 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332798.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| KFTHRHHAGIPPQFLHLRQAQVCKTRLPIPCQPHPHLHPHPHRRRRRRPAPPIRPPRNARHLELPPIGRSPPPLLLLPRRLRRHRLLHVQAQVDLPRGLRLLQAACHVPRPLLHLHGAFP PHSQRQP* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,880.468 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 92.991 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.815 | ||
Secondary Structure Fraction | |||
| Helix | 0.244 | ||
| turn | 0.252 | ||
| sheet | 0.228 | ||