Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332800.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
FLMLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLLHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGH ELFSRLLSQAVDQAKELMDQFQLVHIVASLTLA* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,986.046 | ||
Theoretical pI: | 4.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 39.401 | ||
aromaticity | 0.078 | ||
GRAVY | 0.025 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.203 | ||
sheet | 0.294 |