| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332801.1 | internal | 164 | 3-494(+) |
Amino Acid sequence : | |||
| SAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDIVDELYPTWAAGLASQKMKRESAADASTGGSSGPMGPVFSTFVYEEEPGNELKLDAIHGFAREGDEENLRKCIESGVPVNIKDS EGRTPLHWAVDRGHVNITALLLNKNADVNAKDGEGQTPLHYPAV | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 13,684.946 | ||
| Theoretical pI: | 10.121 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 48.933 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.244 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332801.1 | 5prime_partial | 123 | 494-123(-) |
Amino Acid sequence : | |||
| HSRVMQRGLTFTILSINIGVLVQKQCSYIHMASIHSPVQRSSALTVFYIYGYPALNALAKVLFISFSCKTMNSIQFQLISRFLLIYKRTKDRTHRSTGASCGCICSTFTFHLLTGKTGSP SGI* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,684.946 | ||
| Theoretical pI: | 10.121 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 48.933 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.244 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332801.1 | internal | 164 | 3-494(+) |
Amino Acid sequence : | |||
| SAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIDIVDELYPTWAAGLASQKMKRESAADASTGGSSGPMGPVFSTFVYEEEPGNELKLDAIHGFAREGDEENLRKCIESGVPVNIKDS EGRTPLHWAVDRGHVNITALLLNKNADVNAKDGEGQTPLHYPAV | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 13,684.946 | ||
| Theoretical pI: | 10.121 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 48.933 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.244 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332801.1 | 5prime_partial | 123 | 494-123(-) |
Amino Acid sequence : | |||
| HSRVMQRGLTFTILSINIGVLVQKQCSYIHMASIHSPVQRSSALTVFYIYGYPALNALAKVLFISFSCKTMNSIQFQLISRFLLIYKRTKDRTHRSTGASCGCICSTFTFHLLTGKTGSP SGI* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 13,684.946 | ||
| Theoretical pI: | 10.121 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7700 | ||
| Instability index: | 48.933 | ||
| aromaticity | 0.106 | ||
| GRAVY | 0.287 | ||
Secondary Structure Fraction | |||
| Helix | 0.350 | ||
| turn | 0.244 | ||
| sheet | 0.171 | ||