| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332805.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
| ITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEY YNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGATAAGPSPGKTLPRSTGVEPTLSGRRPRA | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 13,379.778 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 108.164 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.954 | ||
Secondary Structure Fraction | |||
| Helix | 0.136 | ||
| turn | 0.456 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332805.1 | 3prime_partial | 125 | 332-706(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPRRRGLLRERPYQGRQEWSLHCQ AGGQE | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,379.778 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 108.164 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.954 | ||
Secondary Structure Fraction | |||
| Helix | 0.136 | ||
| turn | 0.456 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332805.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
| ITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEY YNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGATAAGPSPGKTLPRSTGVEPTLSGRRPRA | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 13,379.778 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 108.164 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.954 | ||
Secondary Structure Fraction | |||
| Helix | 0.136 | ||
| turn | 0.456 | ||
| sheet | 0.120 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332805.1 | 3prime_partial | 125 | 332-706(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPRRRGLLRERPYQGRQEWSLHCQ AGGQE | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 13,379.778 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 108.164 | ||
| aromaticity | 0.032 | ||
| GRAVY | -0.954 | ||
Secondary Structure Fraction | |||
| Helix | 0.136 | ||
| turn | 0.456 | ||
| sheet | 0.120 | ||