| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332817.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| LEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPIL PTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWVYCR | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 12,230.946 | ||
| Theoretical pI: | 4.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34615 | ||
| Instability index: | 36.780 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.270 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332817.1 | 5prime_partial | 107 | 702-379(-) |
Amino Acid sequence : | |||
| AAVDPENSHWLWATDITVDDWWLHTARPVGLHPAICCEGKTRQLLSKVLNHIVSLWLSMNKNINVELFLQLDNLVYLFLDCLNVLLLGDLVGLEFTAHSSELHSLWE* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,230.946 | ||
| Theoretical pI: | 4.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34615 | ||
| Instability index: | 36.780 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.270 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332817.1 | internal | 234 | 1-702(+) |
Amino Acid sequence : | |||
| LEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPIL PTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWVYCR | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 12,230.946 | ||
| Theoretical pI: | 4.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34615 | ||
| Instability index: | 36.780 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.270 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332817.1 | 5prime_partial | 107 | 702-379(-) |
Amino Acid sequence : | |||
| AAVDPENSHWLWATDITVDDWWLHTARPVGLHPAICCEGKTRQLLSKVLNHIVSLWLSMNKNINVELFLQLDNLVYLFLDCLNVLLLGDLVGLEFTAHSSELHSLWE* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,230.946 | ||
| Theoretical pI: | 4.967 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34490 34615 | ||
| Instability index: | 36.780 | ||
| aromaticity | 0.093 | ||
| GRAVY | 0.270 | ||
Secondary Structure Fraction | |||
| Helix | 0.421 | ||
| turn | 0.196 | ||
| sheet | 0.327 | ||