Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332826.1 | 5prime_partial | 238 | 2-718(+) |
Amino Acid sequence : | |||
KLLPDCRGPTIIFFQENAGNIAHRLEMVRIMLQRLQCNVFMLSYRGYGASDGFPSQHGITKDAQAALDHLVQRTDIDTSRIVVFGRSLGGAVGAVLARNNPDKVASLILENTFTSILDMA GVLLPFLKWVIGKSSSKGPKVLNFLVRSPWNTIDIIGEVKQPILFLSGLQDEMVPPSHMEMLYAKAAVHNQNCLFVDFPTGMHMDTWLAGGDRYWRTINEFLEKTVPDKKDSGSSRVD* | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 26,477.313 | ||
Theoretical pI: | 7.910 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 32.626 | ||
aromaticity | 0.084 | ||
GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.244 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332826.1 | 5prime_partial | 238 | 2-718(+) |
Amino Acid sequence : | |||
KLLPDCRGPTIIFFQENAGNIAHRLEMVRIMLQRLQCNVFMLSYRGYGASDGFPSQHGITKDAQAALDHLVQRTDIDTSRIVVFGRSLGGAVGAVLARNNPDKVASLILENTFTSILDMA GVLLPFLKWVIGKSSSKGPKVLNFLVRSPWNTIDIIGEVKQPILFLSGLQDEMVPPSHMEMLYAKAAVHNQNCLFVDFPTGMHMDTWLAGGDRYWRTINEFLEKTVPDKKDSGSSRVD* | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 26,477.313 | ||
Theoretical pI: | 7.910 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 32.626 | ||
aromaticity | 0.084 | ||
GRAVY | -0.047 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.244 | ||
sheet | 0.239 |