| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332839.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
| ASRRHISAVHAAEPAKAPAIATKSAPPPAAKWDPETWKTKNALQLPEYPDEAELESVLKTMEAYPPLVFAGEVRSLEERLAEAAVGKAFLLQGGDCAESFKEFSANNIRDTFRILLQMSV VLSFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPHRMIRAYCQAASTLNLLRAFATGGYAAMQRVTQWNLDFVEHSEQGDRYQELAHRVDEAFG | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,322.437 | ||
| Theoretical pI: | 5.815 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 45.732 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.438 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.218 | ||
| sheet | 0.319 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332839.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
| ASRRHISAVHAAEPAKAPAIATKSAPPPAAKWDPETWKTKNALQLPEYPDEAELESVLKTMEAYPPLVFAGEVRSLEERLAEAAVGKAFLLQGGDCAESFKEFSANNIRDTFRILLQMSV VLSFGGQLPVIKVGRMAGQFAKPRSDPFEEKDGVKLPSYKGDNINGDTFDEKSRIPDPHRMIRAYCQAASTLNLLRAFATGGYAAMQRVTQWNLDFVEHSEQGDRYQELAHRVDEAFG | |||
Physicochemical properties | |||
| Number of amino acids: | 238 | ||
| Molecular weight: | 26,322.437 | ||
| Theoretical pI: | 5.815 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 45.732 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.438 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.218 | ||
| sheet | 0.319 | ||