| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332846.1 | 3prime_partial | 261 | 65-847(+) |
Amino Acid sequence : | |||
| MVGWQRHLQSLVRVVARRYECSGNASFTTLNHAKASLVSGEVPSLSSLRNSLCPTITRSLFLQMQKLEFTSSRSLLAAEEPISSPLVPALPTSSGNTETQRTICKSSKVQAVLKGIKQSP KKLNLVAALVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANATHNHGLNPDRLLVAEAFVGKGQYLKRISYHARGRSGIRERARSRLTVVVREITADEETEIAKVKVHNFRKLTKREK RLVPHQLIENTPVWDSKSKSR | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,118.385 | ||
| Theoretical pI: | 10.770 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 51.964 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.222 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332846.1 | 3prime_partial | 261 | 65-847(+) |
Amino Acid sequence : | |||
| MVGWQRHLQSLVRVVARRYECSGNASFTTLNHAKASLVSGEVPSLSSLRNSLCPTITRSLFLQMQKLEFTSSRSLLAAEEPISSPLVPALPTSSGNTETQRTICKSSKVQAVLKGIKQSP KKLNLVAALVRGMRVEDALLQLQVTVKRAAKTVYQVIHSARANATHNHGLNPDRLLVAEAFVGKGQYLKRISYHARGRSGIRERARSRLTVVVREITADEETEIAKVKVHNFRKLTKREK RLVPHQLIENTPVWDSKSKSR | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 29,118.385 | ||
| Theoretical pI: | 10.770 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 51.964 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.343 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.222 | ||
| sheet | 0.264 | ||