| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332863.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| SSSLSLRNKNLEMAKSPETEHPVKAVGWAARDTSGSLSPFNFSRRETGEHDVQFKVLYCGVCHSDLHMVKNEWGFTQYPIVPGHEIVGIVTEVGSKVDKFKVGDKVGVGCLVGSCRECDQ CSNDLENYCAKQILTYSMPYIDGTITYGGYSDLMVADEHFIVRWPENFSMDIGAPLLCAGITTYSPLRYYGLDKPGLNVGVVGLGGLGHVAVKFAKAFGTXVTVISTSLS | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 13,954.253 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 121.885 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.216 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332863.1 | complete | 111 | 329-664(+) |
Amino Acid sequence : | |||
| MPRRLVPRMRSMFERPRKLLRQTDPHLQHALHRRHHHLRRLLRPNGGRRALHRPLARKLLNGHRSPPPLRRHHHLQPSTILRPRQTRPQRRRRRPWWPRPRRREVRQGFRD* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 13,954.253 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 121.885 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.216 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332863.1 | internal | 230 | 3-692(+) |
Amino Acid sequence : | |||
| SSSLSLRNKNLEMAKSPETEHPVKAVGWAARDTSGSLSPFNFSRRETGEHDVQFKVLYCGVCHSDLHMVKNEWGFTQYPIVPGHEIVGIVTEVGSKVDKFKVGDKVGVGCLVGSCRECDQ CSNDLENYCAKQILTYSMPYIDGTITYGGYSDLMVADEHFIVRWPENFSMDIGAPLLCAGITTYSPLRYYGLDKPGLNVGVVGLGGLGHVAVKFAKAFGTXVTVISTSLS | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 13,954.253 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 121.885 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.216 | ||
| sheet | 0.207 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332863.1 | complete | 111 | 329-664(+) |
Amino Acid sequence : | |||
| MPRRLVPRMRSMFERPRKLLRQTDPHLQHALHRRHHHLRRLLRPNGGRRALHRPLARKLLNGHRSPPPLRRHHHLQPSTILRPRQTRPQRRRRRPWWPRPRRREVRQGFRD* | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 13,954.253 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11000 | ||
| Instability index: | 121.885 | ||
| aromaticity | 0.036 | ||
| GRAVY | -1.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.216 | ||
| sheet | 0.207 | ||