Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332864.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDE | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 19,801.545 | ||
Theoretical pI: | 8.499 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 46.807 | ||
aromaticity | 0.093 | ||
GRAVY | -0.505 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.203 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332864.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDE | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 19,801.545 | ||
Theoretical pI: | 8.499 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 46.807 | ||
aromaticity | 0.093 | ||
GRAVY | -0.505 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.203 | ||
sheet | 0.238 |