| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332864.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
| RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDE | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,801.545 | ||
| Theoretical pI: | 8.499 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 46.807 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.203 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332864.1 | internal | 172 | 516-1(-) |
Amino Acid sequence : | |||
| RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDE | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,801.545 | ||
| Theoretical pI: | 8.499 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 46.807 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.505 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.203 | ||
| sheet | 0.238 | ||