| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332865.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
| RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,144.877 | ||
| Theoretical pI: | 6.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 47.277 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.513 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332865.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
| RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 20,144.877 | ||
| Theoretical pI: | 6.838 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
| Instability index: | 47.277 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.513 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.200 | ||
| sheet | 0.240 | ||