Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332865.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 20,144.877 | ||
Theoretical pI: | 6.838 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 47.277 | ||
aromaticity | 0.091 | ||
GRAVY | -0.513 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.200 | ||
sheet | 0.240 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332865.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
RLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPM TVYWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVED | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 20,144.877 | ||
Theoretical pI: | 6.838 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 47.277 | ||
aromaticity | 0.091 | ||
GRAVY | -0.513 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.200 | ||
sheet | 0.240 |