Acc_NO	ORF type	length	start-end position (strand +/-)
>DY332869.1	complete	141	159-584(+)
Amino Acid sequence :
MAAIYSLYIINKSGGLIFYKDYGSAGRMDTNDSLRLASLWHSMHAISQQLSPISGCSGIELLQADTFDLNCFQSLTGTKFFVVCEPGTLHMENLLKHIYELYTDYVLKNPFYEMEMPIRC ELFDINLAQAVQKDRVAMLGR*
Physicochemical properties
Number of amino acids:		141
Molecular weight:		16,017.344
Theoretical pI:		5.454
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17420 17670
Instability index:		43.490
aromaticity		0.113
GRAVY		0.043
Secondary Structure Fraction
Helix		0.348
turn		0.213
sheet		0.291