Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332873.1 | 5prime_partial | 208 | 2-628(+) |
Amino Acid sequence : | |||
LVVEELTVPEYLQFKEELVNGTSNGNFVLELDFAPFTASFPKPTLTKSIGNGVEFLNRHLSAKMFHDRDSMTPLLDFLRMHNYNGKTMMLNDRIRNLNSLQSVLRKAEEYLSTLPPETLY GDFEHKFQEIGLERGWGDTAERVSEMISMLLDLLEAPDSCTLEKFLGRIPMVFNVVILSPHGYLLKKMSWAILIQEGRLFTFWIKFLH* | |||
Physicochemical properties | |||
Number of amino acids: | 208 | ||
Molecular weight: | 24,034.564 | ||
Theoretical pI: | 5.546 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 41.052 | ||
aromaticity | 0.111 | ||
GRAVY | -0.098 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.221 | ||
sheet | 0.317 |