Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332889.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
KAGSMDRARQVLVEMARIQIPANLITYNILLKGYCHQLQIDKAEDLMREMIEEAGIEPDVVSYNTLIDGCILVDDCAGALTYFNEMRKRGIAPSKVSYTTLMKAFASSGQPKLANQVFDE MLKDPRVKVDLVAWNMLVEGYCKMGLVEEAKSVIQKMKDNGMFPNVATYGSLANGIALAKKPGEALLLWNEVKERCGVEENSSNLPPLKPDEGLLDTLADICVRAAF | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,078.918 | ||
Theoretical pI: | 5.119 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
Instability index: | 27.233 | ||
aromaticity | 0.062 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.207 | ||
sheet | 0.330 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332889.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
KAGSMDRARQVLVEMARIQIPANLITYNILLKGYCHQLQIDKAEDLMREMIEEAGIEPDVVSYNTLIDGCILVDDCAGALTYFNEMRKRGIAPSKVSYTTLMKAFASSGQPKLANQVFDE MLKDPRVKVDLVAWNMLVEGYCKMGLVEEAKSVIQKMKDNGMFPNVATYGSLANGIALAKKPGEALLLWNEVKERCGVEENSSNLPPLKPDEGLLDTLADICVRAAF | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,078.918 | ||
Theoretical pI: | 5.119 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
Instability index: | 27.233 | ||
aromaticity | 0.062 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.207 | ||
sheet | 0.330 |