| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332889.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| KAGSMDRARQVLVEMARIQIPANLITYNILLKGYCHQLQIDKAEDLMREMIEEAGIEPDVVSYNTLIDGCILVDDCAGALTYFNEMRKRGIAPSKVSYTTLMKAFASSGQPKLANQVFDE MLKDPRVKVDLVAWNMLVEGYCKMGLVEEAKSVIQKMKDNGMFPNVATYGSLANGIALAKKPGEALLLWNEVKERCGVEENSSNLPPLKPDEGLLDTLADICVRAAF | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,078.918 | ||
| Theoretical pI: | 5.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
| Instability index: | 27.233 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.207 | ||
| sheet | 0.330 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332889.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| KAGSMDRARQVLVEMARIQIPANLITYNILLKGYCHQLQIDKAEDLMREMIEEAGIEPDVVSYNTLIDGCILVDDCAGALTYFNEMRKRGIAPSKVSYTTLMKAFASSGQPKLANQVFDE MLKDPRVKVDLVAWNMLVEGYCKMGLVEEAKSVIQKMKDNGMFPNVATYGSLANGIALAKKPGEALLLWNEVKERCGVEENSSNLPPLKPDEGLLDTLADICVRAAF | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,078.918 | ||
| Theoretical pI: | 5.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21805 | ||
| Instability index: | 27.233 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.207 | ||
| sheet | 0.330 | ||