Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY332891.1 | 5prime_partial | 214 | 2-646(+) |
Amino Acid sequence : | |||
ERSLIANLSAANCYKPDHLKKPENWALVEKAKYYYMAGFFLTVSPESMLLVAEHAIANNKVFATNLSAPFICEFFKEAQEKILPYTDFVFGNETEALTFSRVHGWETENIQEIALKISQW PKASGTHKRITVITQGADPVIVAEDGKVKLLPVIPLPKEKLIDTNGAGDAFVGGFLSQLVLGKPIEECVRAGCYGANVIIQRSGCTYPEKPDFK* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 23,697.035 | ||
Theoretical pI: | 6.145 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
Instability index: | 35.683 | ||
aromaticity | 0.103 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.220 | ||
sheet | 0.276 |