| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332897.1 | 3prime_partial | 212 | 38-673(+) |
Amino Acid sequence : | |||
| MGSSGFSWKLNDHPKLPKGKTIAMVVLDGWGEANANQYNCIHIAETPTMDSLKKGAPEKWRLVRAHGKAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDIALETGKIFDGDGFKYIK ESFETGTLHLIGLLSDGGVHSRLDQLQLLLKGVSERGAKRIRCHILTDGRDVLDGTSVGFVETLENDLAKLREKGIDAQIASGGGRMYVTMD | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 22,842.780 | ||
| Theoretical pI: | 6.385 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 20.918 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.245 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY332897.1 | 3prime_partial | 212 | 38-673(+) |
Amino Acid sequence : | |||
| MGSSGFSWKLNDHPKLPKGKTIAMVVLDGWGEANANQYNCIHIAETPTMDSLKKGAPEKWRLVRAHGKAVGLPTEDDMGNSEVGHNALGAGRIFAQGAKLVDIALETGKIFDGDGFKYIK ESFETGTLHLIGLLSDGGVHSRLDQLQLLLKGVSERGAKRIRCHILTDGRDVLDGTSVGFVETLENDLAKLREKGIDAQIASGGGRMYVTMD | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 22,842.780 | ||
| Theoretical pI: | 6.385 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 20.918 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.277 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.245 | ||
| sheet | 0.269 | ||